PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020618m
Common NameCARUB_v10020618mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 337aa    MW: 37660.8 Da    PI: 6.3136
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020618mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W++++   g+ R+ k+c++rw +yl
  Carubv10020618m 14 KGPWTPEEDIILVSYIQQHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding482.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Carubv10020618m  67 RGNFTPSEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.95965IPR017930Myb domain
SuperFamilySSF466893.44E-3012108IPR009057Homeodomain-like
SMARTSM007172.5E-141363IPR001005SANT/Myb domain
PfamPF002493.8E-161461IPR001005SANT/Myb domain
CDDcd001673.52E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2465117IPR009057Homeodomain-like
SMARTSM007177.1E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129419.27866116IPR017930Myb domain
PfamPF002491.6E-1467112IPR001005SANT/Myb domain
CDDcd001678.19E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRPPCCEKI EVKKGPWTPE EDIILVSYIQ QHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIRRGNF TPSEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNFWNT HLKKKLVTTK  120
LQNGFINEDK TNMATEISSC NNNNNRCNHN KRITNKGQWE KKLQTDINMA KQALFQALSL  180
DQPSSSIPLD PDDSPKSNHH SATDTYASNT ENISKLLQNW TSSTSSRPNT SSLSINRSSS  240
TGEEGVFDHH SLFSSNSESG SVDEKLNLMP ETSMLQGESK TSIDMEATAD NQGSLSLIEK  300
WLFDDQGLVQ CGDNQEGIID VSLEGEKNDN NSPDLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-251111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00235DAPTransfer from AT1G74650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0294810.0BT029481.1 Arabidopsis thaliana At1g74650 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302520.10.0hypothetical protein CARUB_v10020618mg
SwissprotP813921e-102MYB06_ANTMA; Myb-related protein 306
TrEMBLR0IF920.0R0IF92_9BRAS; Uncharacterized protein
STRINGAT1G74650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74650.11e-161myb domain protein 31